PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK10271.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 374aa    MW: 43214.4 Da    PI: 7.535
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK10271.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.72.7e-54161461129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                +ppGfrFhPtdeel+ +yLkkkv+ ++++l +vi+evd++k+ePwdL++  ++ +  ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++++++
  PK10271.1  16 VPPGFRFHPTDEELLYYYLKKKVSYEPIDL-DVIREVDLNKLEPWDLKEkcRIGSgPQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIHVSDT 114
                69****************************.9***************952444443456***************************************** PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                + +g++ktLvfy+grap+g+ktdW+mheyrle
  PK10271.1 115 KRIGMRKTLVFYTGRAPHGQKTDWIMHEYRLE 146
                ******************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-606172IPR003441NAC domain
PROSITE profilePS5100558.4516172IPR003441NAC domain
PfamPF023653.0E-2817145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010455Biological Processpositive regulation of cell fate commitment
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
XYNMNMGEGS NGQLTVPPGF RFHPTDEELL YYYLKKKVSY EPIDLDVIRE VDLNKLEPWD  60
LKEKCRIGSG PQNEWYFFSH KDKKYPTGTR TNRATAAGFW KATGRDKAIH VSDTKRIGMR  120
KTLVFYTGRA PHGQKTDWIM HEYRLEDNDT TTAAPADQIQ EDGWVVCRVF KKKNHNRSFQ  180
PELGNNNNNN QEELSYHPQM KTSINGNSTP LVLDHHHHQH LHHQHHQPKH FQQLYDNYTF  240
DHHGSMQLPQ LXPASGGISL NPIDLECSHN LLRLTSNGCG GMQVPAVPER FNGGDWTFLD  300
KLLANSNHQH QQQQQQQQQQ HHHLAHQAKC HPSSSSDHHQ VTHDHDHVAG NTTTQRLFPF  360
QYLGCDNDIL KFSK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-511317414167NO APICAL MERISTEM PROTEIN
1ut4_B8e-511317414167NO APICAL MERISTEM PROTEIN
1ut7_A8e-511317414167NO APICAL MERISTEM PROTEIN
1ut7_B8e-511317414167NO APICAL MERISTEM PROTEIN
3swm_A1e-501317417170NAC domain-containing protein 19
3swm_B1e-501317417170NAC domain-containing protein 19
3swm_C1e-501317417170NAC domain-containing protein 19
3swm_D1e-501317417170NAC domain-containing protein 19
3swp_A1e-501317417170NAC domain-containing protein 19
3swp_B1e-501317417170NAC domain-containing protein 19
3swp_C1e-501317417170NAC domain-containing protein 19
3swp_D1e-501317417170NAC domain-containing protein 19
4dul_A8e-511317414167NAC domain-containing protein 19
4dul_B8e-511317414167NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00250DAPTransfer from AT1G79580Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007213444.11e-161hypothetical protein PRUPE_ppa025341mg
SwissprotQ9MA171e-121SMB_ARATH; Protein SOMBRERO
TrEMBLM5WZ811e-161M5WZ81_PRUPE; Uncharacterized protein
STRINGPOPTR_0010s18420.11e-142(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72043447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.35e-97NAC family protein